PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA37G00099
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 282aa    MW: 32172.7 Da    PI: 4.7583
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA37G00099genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.5e-151663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+++Ed +l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
       AA37G00099 16 RGPWSQDEDFKLISFINKFGHENWRSLPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding49.59.6e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE++ ++++++ +G++ W++Ia++++ gRt++++k+ w+++l
       AA37G00099  69 RGNFSVEEEDTIIKLHQSFGNK-WSKIASKLP-GRTDNEIKNVWHTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-23766IPR009057Homeodomain-like
PROSITE profilePS5129413.3921163IPR017930Myb domain
SuperFamilySSF466895.99E-2914110IPR009057Homeodomain-like
SMARTSM007173.0E-121565IPR001005SANT/Myb domain
PfamPF002494.0E-141663IPR001005SANT/Myb domain
CDDcd001677.97E-91863No hitNo description
PROSITE profilePS5129424.82864118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2667118IPR009057Homeodomain-like
SMARTSM007172.0E-1468116IPR001005SANT/Myb domain
PfamPF002491.6E-1469114IPR001005SANT/Myb domain
CDDcd001672.04E-971114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGKGRAPCCD KTKVKRGPWS QDEDFKLISF INKFGHENWR SLPKQAGLLR CGKSCRLRWI  60
NYLRPDVKRG NFSVEEEDTI IKLHQSFGNK WSKIASKLPG RTDNEIKNVW HTHLKKRVLQ  120
SSQTNLNIDE SASPCSSDSV SGCGKVAKIQ AEISQESYPN ASVSSGGSNV SSIRDDLQIG  180
ETFEDFMDIF EEVDKPELLE IPFDLDPEIW SLIDGSDSFQ QPENNLRQVS DEDEVEKWFK  240
HLESELGLEE NDNQQKHKHG ETRDGDEEES SSLLESYELL IH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25161187108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00144DAPTransfer from AT1G16490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173098.11e-143myb domain protein 58
TrEMBLQ8LEE51e-145Q8LEE5_ARATH; Putative myb-related transcription factor
STRINGAT1G16490.11e-143(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.11e-132myb domain protein 58